![]() | Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
![]() | Fold d.3: Cysteine proteinases [54000] (1 superfamily) consists of one alpha-helix and 4 strands of antiparallel beta-sheet and contains the catalytic triad Cys-His-Asn |
![]() | Superfamily d.3.1: Cysteine proteinases [54001] (24 families) ![]() the constitute families differ by insertion into and circular permutation of the common catalytic core made of one alpha-helix and 3-strands of beta-sheet |
![]() | Family d.3.1.1: Papain-like [54002] (26 proteins) |
![]() | Protein automated matches [190264] (12 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187102] (9 PDB entries) |
![]() | Domain d3pdfa2: 3pdf A:206-439 [233217] Other proteins in same PDB: d3pdfa1, d3pdfa3 automated match to d1jqpa2 complexed with cl, lxv, nag |
PDB Entry: 3pdf (more details), 1.85 Å
SCOPe Domain Sequences for d3pdfa2:
Sequence, based on SEQRES records: (download)
>d3pdfa2 d.3.1.1 (A:206-439) automated matches {Human (Homo sapiens) [TaxId: 9606]} flptswdwrnvhginfvspvrnqascgscysfasmgmleaririltnnsqtpilspqevv scsqyaqgceggfpyliagkyaqdfglveeacfpytgtdspckmkedcfryysseyhyvg gfyggcnealmklelvhhgpmavafevyddflhykkgiyhhtglrdpfnpfeltnhavll vgygtdsasgmdywivknswgtgwgengyfrirrgtdecaiesiavaatpipkl
>d3pdfa2 d.3.1.1 (A:206-439) automated matches {Human (Homo sapiens) [TaxId: 9606]} flptswdwrnvhginfvspvrnqascgscysfasmgmleaririltnnsqtpilspqevv scsqyaqgceggfpyliagkyaqdfglveeacfpytgtdspckmkedcfryysseyhyvg gfyggcnealmklelvhhgpmavafevyddflhykkgiyhhtdpfnpfeltnhavllvgy gtdsasgmdywivknswgtgwgengyfrirrgtdecaiesiavaatpipkl
Timeline for d3pdfa2: