Lineage for d3pdfa1 (3pdf A:1-118)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2396657Fold b.61: Streptavidin-like [50875] (8 superfamilies)
    barrel, closed; n=8, S=10; meander
  4. 2397304Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) (S)
    automatically mapped to Pfam PF08773
  5. 2397323Family b.61.5.0: automated matches [233213] (1 protein)
    not a true family
  6. 2397324Protein automated matches [233214] (1 species)
    not a true protein
  7. 2397325Species Human (Homo sapiens) [TaxId:9606] [233215] (1 PDB entry)
  8. 2397326Domain d3pdfa1: 3pdf A:1-118 [233216]
    Other proteins in same PDB: d3pdfa2, d3pdfa3
    automated match to d1jqpa1
    complexed with cl, lxv, nag

Details for d3pdfa1

PDB Entry: 3pdf (more details), 1.85 Å

PDB Description: Discovery of Novel Cyanamide-Based Inhibitors of Cathepsin C
PDB Compounds: (A:) Dipeptidyl peptidase 1

SCOPe Domain Sequences for d3pdfa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3pdfa1 b.61.5.0 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf
tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv

SCOPe Domain Coordinates for d3pdfa1:

Click to download the PDB-style file with coordinates for d3pdfa1.
(The format of our PDB-style files is described here.)

Timeline for d3pdfa1: