Class b: All beta proteins [48724] (180 folds) |
Fold b.61: Streptavidin-like [50875] (8 superfamilies) barrel, closed; n=8, S=10; meander |
Superfamily b.61.5: Dipeptidyl peptidase I (cathepsin C), exclusion domain [75001] (2 families) automatically mapped to Pfam PF08773 |
Family b.61.5.0: automated matches [233213] (1 protein) not a true family |
Protein automated matches [233214] (1 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [233215] (1 PDB entry) |
Domain d3pdfa1: 3pdf A:1-118 [233216] Other proteins in same PDB: d3pdfa2, d3pdfa3 automated match to d1jqpa1 complexed with cl, lxv, nag |
PDB Entry: 3pdf (more details), 1.85 Å
SCOPe Domain Sequences for d3pdfa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3pdfa1 b.61.5.0 (A:1-118) automated matches {Human (Homo sapiens) [TaxId: 9606]} dtpanctyldllgtwvfqvgssgsqrdvncsvmgpqekkvvvylqkldtayddlgnsghf tiiynqgfeivlndykwfaffkykeegskvttycnetmtgwvhdvlgrnwacftgkkv
Timeline for d3pdfa1: