SCOP 1.63: Domain d1f15b_: 1f15 B:

Lineage for d1f15b_ (1f15 B:)

1. Root: SCOP 1.63

2. Class b: All beta proteins [48724] (119 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
   sandwich; 8 strands in 2 sheets; jelly-roll
   variations: some members have additional 1-2 strands

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (18 proteins)

6. Protein CMV coat protein [49645] (1 species)

7. Species Cucumber mosaic virus, strain fny [TaxId:12305] [49646] (1 PDB entry)

8. Domain d1f15b_: 1f15 B: [23321]

Details for d1f15b_

PDB Entry: 1f15, 3.2 Å

PDB Description: cucumber mosaic virus (strain fny)

SCOP Domain Sequences for d1f15b_:

Sequence; same for both SEQRES and ATOM records:

>d1f15b_ b.10.1.2 (B:) CMV coat protein {Cucumber mosaic virus, strain fny}
danfrvlsqqlsrlnktlaagrptinhptfvgsercrpgytftsitlkppkidrgsyygk
rlllpdsvteydkklvsrlqirvnplpkfdstvwvtvrkvpassdlsvaaisamfadgas
pvlvyqyaasgvqannkllydlsamradigdmrkyavlvyskddaletdelvlhvdiehq
riptsgvlpv

Timeline for d1f15b_:

• d1f15b_ first appeared (with stable ids) in SCOP 1.55
  
• d1f15b_ appears in SCOP 1.61
  
• d1f15b_ appears in SCOP 1.65
  
• d1f15b_ appears in the current release, SCOPe 2.08