Lineage for d1f15b_ (1f15 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2821496Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2821778Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2822292Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)
  6. 2822293Protein Cucumovirus coat protein [88640] (4 species)
  7. 2822330Species CMV (Cucumber mosaic virus), strain fny [TaxId:12305] [49646] (1 PDB entry)
  8. 2822332Domain d1f15b_: 1f15 B: [23321]

Details for d1f15b_

PDB Entry: 1f15 (more details), 3.2 Å

PDB Description: cucumber mosaic virus (strain fny)
PDB Compounds: (B:) coat protein

SCOPe Domain Sequences for d1f15b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1f15b_ b.121.4.5 (B:) Cucumovirus coat protein {CMV (Cucumber mosaic virus), strain fny [TaxId: 12305]}
danfrvlsqqlsrlnktlaagrptinhptfvgsercrpgytftsitlkppkidrgsyygk
rlllpdsvteydkklvsrlqirvnplpkfdstvwvtvrkvpassdlsvaaisamfadgas
pvlvyqyaasgvqannkllydlsamradigdmrkyavlvyskddaletdelvlhvdiehq
riptsgvlpv

SCOPe Domain Coordinates for d1f15b_:

Click to download the PDB-style file with coordinates for d1f15b_.
(The format of our PDB-style files is described here.)

Timeline for d1f15b_: