Lineage for d3p9xb_ (3p9x B:)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1864352Fold c.65: Formyltransferase [53327] (1 superfamily)
    3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest
  4. 1864353Superfamily c.65.1: Formyltransferase [53328] (2 families) (S)
  5. 1864453Family c.65.1.0: automated matches [191608] (1 protein)
    not a true family
  6. 1864454Protein automated matches [191110] (9 species)
    not a true protein
  7. 1864465Species Bacillus halodurans [TaxId:272558] [233206] (1 PDB entry)
  8. 1864467Domain d3p9xb_: 3p9x B: [233208]
    automated match to d4ds3a_
    complexed with gol, so4

Details for d3p9xb_

PDB Entry: 3p9x (more details), 1.9 Å

PDB Description: Crystal structure of phosphoribosylglycinamide formyltransferase from Bacillus Halodurans
PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d3p9xb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9xb_ c.65.1.0 (B:) automated matches {Bacillus halodurans [TaxId: 272558]}
krvaifasgsgtnaeaiiqsqkagqlpcevallitdkpgakvvervkvheipvcaldpkt
ypskeayeievvqqlkekqidfvvlagymrlvgptllgayegrivnihpsllpafpglha
ieqairanvkvtgvtihyvdegmdtgpiiaqeavsieeedtletlttkiqavehrlypat
lhkllskaenlyfq

SCOPe Domain Coordinates for d3p9xb_:

Click to download the PDB-style file with coordinates for d3p9xb_.
(The format of our PDB-style files is described here.)

Timeline for d3p9xb_: