SCOPe 2.08: Domain d3p9xb1: 3p9x B:2-188

Lineage for d3p9xb1 (3p9x B:2-188)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.65: Formyltransferase [53327] (1 superfamily)
   3 layers: a/b/a; mixed beta-sheet of 7 strands, order 3214567; strand 6 is antiparallel to the rest

4. Superfamily c.65.1: Formyltransferase [53328] (2 families)

5. Family c.65.1.0: automated matches [191608] (1 protein)
   not a true family

6. Protein automated matches [191110] (11 species)
   not a true protein

7. Species Bacillus halodurans [TaxId:272558] [233206] (1 PDB entry)

8. Domain d3p9xb1: 3p9x B:2-188 [233208]
   Other proteins in same PDB: d3p9xa2, d3p9xb2
   automated match to d4ds3a_
   complexed with gol, so4

Details for d3p9xb1

PDB Entry: 3p9x, 1.9 Å

PDB Description: Crystal structure of phosphoribosylglycinamide formyltransferase from Bacillus Halodurans

PDB Compounds: (B:) phosphoribosylglycinamide formyltransferase

SCOPe Domain Sequences for d3p9xb1:

Sequence; same for both SEQRES and ATOM records:

>d3p9xb1 c.65.1.0 (B:2-188) automated matches {Bacillus halodurans [TaxId: 272558]}
krvaifasgsgtnaeaiiqsqkagqlpcevallitdkpgakvvervkvheipvcaldpkt
ypskeayeievvqqlkekqidfvvlagymrlvgptllgayegrivnihpsllpafpglha
ieqairanvkvtgvtihyvdegmdtgpiiaqeavsieeedtletlttkiqavehrlypat
lhkllsk

Timeline for d3p9xb1:

• d3p9xb1 first appeared in SCOPe 2.03, called d3p9xb_
  
• d3p9xb1 appears in SCOPe 2.07