SCOPe 2.05: Domain d1f15a_: 1f15 A:

Lineage for d1f15a_ (1f15 A:)

1. Root: SCOPe 2.05

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.5: Bromoviridae-like VP [88639] (2 proteins)

6. Protein Cucumovirus coat protein [88640] (4 species)

7. Species CMV (Cucumber mosaic virus), strain fny [TaxId:12305] [49646] (1 PDB entry)

8. Domain d1f15a_: 1f15 A: [23320]

Details for d1f15a_

PDB Entry: 1f15, 3.2 Å

PDB Description: cucumber mosaic virus (strain fny)

PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d1f15a_:

Sequence; same for both SEQRES and ATOM records:

>d1f15a_ b.121.4.5 (A:) Cucumovirus coat protein {CMV (Cucumber mosaic virus), strain fny [TaxId: 12305]}
ercrpgytftsitlkppkidrgsyygkrlllpdsvteydkklvsrlqirvnplpkfdstv
wvtvrkvpassdlsvaaisamfadgaspvlvyqyaasgvqannkllydlsamradigdmr
kyavlvyskddaletdelvlhvdiehqriptsgvlpv

Timeline for d1f15a_:

• d1f15a_ first appeared (with stable ids) in SCOP 1.55
  
• d1f15a_ appears in SCOPe 2.04
  
• d1f15a_ appears in SCOPe 2.06
  
• d1f15a_ appears in the current release, SCOPe 2.08