Lineage for d3p9pd2 (3p9p D:598-753)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1356042Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 1358417Superfamily c.23.16: Class I glutamine amidotransferase-like [52317] (10 families) (S)
    conserved positions of the oxyanion hole and catalytic nucleophile; different constituent families contain different additional structures
  5. 1358810Family c.23.16.0: automated matches [191336] (1 protein)
    not a true family
  6. 1358811Protein automated matches [190197] (10 species)
    not a true protein
  7. 1358828Species Escherichia coli [TaxId:83333] [226043] (12 PDB entries)
  8. 1358840Domain d3p9pd2: 3p9p D:598-753 [233196]
    Other proteins in same PDB: d3p9pa1, d3p9pb1, d3p9pc1, d3p9pd1
    automated match to d1p80a1
    complexed with hdd, hde, hem

Details for d3p9pd2

PDB Entry: 3p9p (more details), 1.5 Å

PDB Description: structure of i274v variant of e. coli kate
PDB Compounds: (D:) catalase hpii

SCOPe Domain Sequences for d3p9pd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9pd2 c.23.16.0 (D:598-753) automated matches {Escherichia coli [TaxId: 83333]}
vkgrvvaillndevrsadllailkalkakgvhakllysrmgevtaddgtvlpiaatfaga
psltvdavivpcgniadiadngdanyylmeaykhlkpialagdarkfkatikiadqgeeg
iveadsadgsfmdelltlmaahrvwsripkidkipa

SCOPe Domain Coordinates for d3p9pd2:

Click to download the PDB-style file with coordinates for d3p9pd2.
(The format of our PDB-style files is described here.)

Timeline for d3p9pd2: