SCOPe 2.08: Domain d3p0wd2: 3p0w D:154-460

Lineage for d3p0wd2 (3p0w D:154-460)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
   contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
   the first seven superfamilies have similar phosphate-binding sites

4. Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families)
   binds metal ion (magnesium or manganese) in conserved site inside barrel
   N-terminal alpha+beta domain is common to this superfamily

5. Family c.1.11.0: automated matches [227196] (1 protein)
   not a true family

6. Protein automated matches [226923] (79 species)
   not a true protein

7. Species Ralstonia pickettii [TaxId:402626] [233179] (1 PDB entry)

8. Domain d3p0wd2: 3p0w D:154-460 [233190]
   Other proteins in same PDB: d3p0wa1, d3p0wb1, d3p0wc1, d3p0wd1
   automated match to d4it1d2
   complexed with gkr, mg

Details for d3p0wd2

PDB Entry: 3p0w, 1.71 Å

PDB Description: crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate

PDB Compounds: (D:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3p0wd2:

Sequence; same for both SEQRES and ATOM records:

>d3p0wd2 c.1.11.0 (D:154-460) automated matches {Ralstonia pickettii [TaxId: 402626]}
agqqrdsapmlaylfyvgdrrktdlpylegangaddwlrlrheaamtpaaiarlaeaate
rygfadfklkggvmpgaeemeaiaaikarfpharvtldpngawslneaialckgqghlva
yaedpcgpeagysgrevmaefkratgiptatnmiatdwrqmghavqlhavdipladphfw
tmqgsvrvaqlcdewgltwgshsnnhfdvslamfthvaaaapgnitaidthwiwqeaqer
ltreplriqgghvavperpglgieidmdrvmaahalyktlgpgarddamamqylvpgwty
dpkrpsl

Timeline for d3p0wd2:

• d3p0wd2 first appeared in SCOPe 2.03
  
• d3p0wd2 appears in SCOPe 2.07