Lineage for d3p0wd2 (3p0w D:154-460)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837712Species Ralstonia pickettii [TaxId:402626] [233179] (1 PDB entry)
  8. 2837716Domain d3p0wd2: 3p0w D:154-460 [233190]
    Other proteins in same PDB: d3p0wa1, d3p0wb1, d3p0wc1, d3p0wd1
    automated match to d4it1d2
    complexed with gkr, mg

Details for d3p0wd2

PDB Entry: 3p0w (more details), 1.71 Å

PDB Description: crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
PDB Compounds: (D:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3p0wd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p0wd2 c.1.11.0 (D:154-460) automated matches {Ralstonia pickettii [TaxId: 402626]}
agqqrdsapmlaylfyvgdrrktdlpylegangaddwlrlrheaamtpaaiarlaeaate
rygfadfklkggvmpgaeemeaiaaikarfpharvtldpngawslneaialckgqghlva
yaedpcgpeagysgrevmaefkratgiptatnmiatdwrqmghavqlhavdipladphfw
tmqgsvrvaqlcdewgltwgshsnnhfdvslamfthvaaaapgnitaidthwiwqeaqer
ltreplriqgghvavperpglgieidmdrvmaahalyktlgpgarddamamqylvpgwty
dpkrpsl

SCOPe Domain Coordinates for d3p0wd2:

Click to download the PDB-style file with coordinates for d3p0wd2.
(The format of our PDB-style files is described here.)

Timeline for d3p0wd2: