Lineage for d1ddlc_ (1ddl C:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431628Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins)
    automatically mapped to Pfam PF00983
  6. 2431629Protein Tymovirus coat protein [88642] (3 species)
  7. 2431630Species DYMV (Desmodium yellow mottle tymovirus) [TaxId:70821] [49644] (1 PDB entry)
  8. 2431633Domain d1ddlc_: 1ddl C: [23319]
    protein/RNA complex

Details for d1ddlc_

PDB Entry: 1ddl (more details), 2.7 Å

PDB Description: desmodium yellow mottle tymovirus
PDB Compounds: (C:) desmodium yellow mottle virus

SCOPe Domain Sequences for d1ddlc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ddlc_ b.121.4.6 (C:) Tymovirus coat protein {DYMV (Desmodium yellow mottle tymovirus) [TaxId: 70821]}
ntkpsllpppvgnpppvisypfqitlaslgtedaadsvsiasnsvlatytalyrhaqlkh
lkatihptymapkyptsvalvwvpanstatstqvldtygglhfciggsvnsvkpidvean
ltnlnpiikasttftdtpkllyyskaqataptsptcyltiqgqielsspllqass

SCOPe Domain Coordinates for d1ddlc_:

Click to download the PDB-style file with coordinates for d1ddlc_.
(The format of our PDB-style files is described here.)

Timeline for d1ddlc_: