Class b: All beta proteins [48724] (165 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (9 families) |
Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein) |
Protein Tymovirus coat protein [88642] (3 species) |
Species DYMV (Desmodium yellow mottle tymovirus) [TaxId:70821] [49644] (1 PDB entry) |
Domain d1ddlc_: 1ddl C: [23319] |
PDB Entry: 1ddl (more details), 2.7 Å
SCOP Domain Sequences for d1ddlc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ddlc_ b.121.4.6 (C:) Tymovirus coat protein {DYMV (Desmodium yellow mottle tymovirus) [TaxId: 70821]} ntkpsllpppvgnpppvisypfqitlaslgtedaadsvsiasnsvlatytalyrhaqlkh lkatihptymapkyptsvalvwvpanstatstqvldtygglhfciggsvnsvkpidvean ltnlnpiikasttftdtpkllyyskaqataptsptcyltiqgqielsspllqass
Timeline for d1ddlc_: