SCOPe 2.08: Domain d3p05c2: 3p05 C:148-219

Lineage for d3p05c2 (3p05 C:148-219)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families)

5. Family a.28.3.0: automated matches [191629] (1 protein)
   not a true family

6. Protein automated matches [191156] (12 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (33 PDB entries)

8. Domain d3p05c2: 3p05 C:148-219 [233186]
   Other proteins in same PDB: d3p05a1, d3p05b1, d3p05c1, d3p05d1, d3p05e1
   automated match to d1e6jp1
   complexed with iod

Details for d3p05c2

PDB Entry: 3p05, 2.5 Å

PDB Description: X-ray structure of pentameric HIV-1 CA

PDB Compounds: (C:) hiv-1 ca

SCOPe Domain Sequences for d3p05c2:

Sequence; same for both SEQRES and ATOM records:

>d3p05c2 a.28.3.0 (C:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

Timeline for d3p05c2:

• d3p05c2 first appeared in SCOPe 2.03
  
• d3p05c2 appears in SCOPe 2.07