Lineage for d3p05b2 (3p05 B:148-219)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731303Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) (S)
  5. 1731376Family a.28.3.0: automated matches [191629] (1 protein)
    not a true family
  6. 1731377Protein automated matches [191156] (8 species)
    not a true protein
  7. 1731386Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (3 PDB entries)
  8. 1731390Domain d3p05b2: 3p05 B:148-219 [233182]
    Other proteins in same PDB: d3p05a1, d3p05b1, d3p05c1, d3p05d1, d3p05e1
    automated match to d1e6jp1
    complexed with iod

Details for d3p05b2

PDB Entry: 3p05 (more details), 2.5 Å

PDB Description: X-ray structure of pentameric HIV-1 CA
PDB Compounds: (B:) hiv-1 ca

SCOPe Domain Sequences for d3p05b2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p05b2 a.28.3.0 (B:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp
gatleemmtacq

SCOPe Domain Coordinates for d3p05b2:

Click to download the PDB-style file with coordinates for d3p05b2.
(The format of our PDB-style files is described here.)

Timeline for d3p05b2: