Class a: All alpha proteins [46456] (286 folds) |
Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies) 4 helices, bundle; helix 3 is shorter than others; up-and-down |
Superfamily a.28.3: Retrovirus capsid dimerization domain-like [47353] (3 families) |
Family a.28.3.0: automated matches [191629] (1 protein) not a true family |
Protein automated matches [191156] (8 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [233043] (3 PDB entries) |
Domain d3p05b2: 3p05 B:148-219 [233182] Other proteins in same PDB: d3p05a1, d3p05b1, d3p05c1, d3p05d1, d3p05e1 automated match to d1e6jp1 complexed with iod |
PDB Entry: 3p05 (more details), 2.5 Å
SCOPe Domain Sequences for d3p05b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p05b2 a.28.3.0 (B:148-219) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} tsildirqgpkepfrdyvdrfyktlraeqasqevknaatetllvqnanpdcktilkalgp gatleemmtacq
Timeline for d3p05b2: