Lineage for d3p0ba1 (3p0b A:1-412)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2097504Fold c.6: 7-stranded beta/alpha barrel [51988] (3 superfamilies)
    variant of beta/alpha barrel; parallel beta-sheet barrel, closed, n=7, S=8; strand order 1234567; some members may have fewer strands
  4. 2097583Superfamily c.6.2: Glycoside hydrolase/deacetylase [88713] (9 families) (S)
    in the different families beta-barrels are similarly distorted but may vary in the number of strands
  5. 2097688Family c.6.2.4: AmyC N-terminal domain-like [102189] (3 protein domains)
    automatically mapped to Pfam PF03065
  6. 2097695Protein automated matches [233144] (1 species)
    not a true protein
  7. 2097696Species Thermus thermophilus [TaxId:274] [233175] (1 PDB entry)
  8. 2097697Domain d3p0ba1: 3p0b A:1-412 [233177]
    Other proteins in same PDB: d3p0ba2, d3p0ba3
    automated match to d1ufaa2
    complexed with gol

Details for d3p0ba1

PDB Entry: 3p0b (more details), 1.35 Å

PDB Description: Thermus thermophilus family GH57 branching enzyme: crystal structure, mechanism of action and products formed
PDB Compounds: (A:) TT1467 protein

SCOPe Domain Sequences for d3p0ba1:

Sequence, based on SEQRES records: (download)

>d3p0ba1 c.6.2.4 (A:1-412) automated matches {Thermus thermophilus [TaxId: 274]}
marfalvlhahlpyvrahgmwpfgeetlyeamaetylplirvlerlraegveapftlgit
pilaeqladarikegfwayakdrleraqgdyqryrgtaleasarhqvafweltldhfqrl
sgdlvaafrkaeeggqvelitsnathgyspllgydealwaqiktgvstyrrhfakdptgf
wlpemayrpkgpwkppvegppegvrpgvdellmragirytfvdahlvqggeplspygeaa
lgpvesqeatyhvhelesglrvlarnpettlqvwsadygypgeglyrefhrkdplsglhh
wrvthrkadlaekapydpeaafakteeharhfvgllerlagrhpegvilspydaelfghw
wyegvawleavlrllaqnpkvrpvtareavqgpavrtalpegswgrggdhrv

Sequence, based on observed residues (ATOM records): (download)

>d3p0ba1 c.6.2.4 (A:1-412) automated matches {Thermus thermophilus [TaxId: 274]}
marfalvlhahlpyvrahgmwpfgeetlyeamaetylplirvlerlraegveapftlgit
pilaeqladarikegfwayakdrleraqgdyqryrgtaleasarhqvafweltldhfqrl
sgdlvaafrkaeeggqvelitsnathgyspllgydealwaqiktgvstyrrhfakdptgf
wlpemayrpkgpwkppvegppegvrpgvdellmragirytfvdahlvqggeplspvesqe
atyhvhelesglrvlarnpettlqvwsadygypgeglyrefhrkdplsglhhwrvthrka
dlaekapydpeaafakteeharhfvgllerlagrhpegvilspydaelfghwwyegvawl
eavlrllaqnpkvrpvtareavqgpavrtalpegswgrggdhrv

SCOPe Domain Coordinates for d3p0ba1:

Click to download the PDB-style file with coordinates for d3p0ba1.
(The format of our PDB-style files is described here.)

Timeline for d3p0ba1: