Lineage for d3p9sa1 (3p9s A:28-597)

  1. Root: SCOPe 2.03
  2. 1449807Class e: Multi-domain proteins (alpha and beta) [56572] (66 folds)
  3. 1451042Fold e.5: Heme-dependent catalase-like [56633] (1 superfamily)
    contains an (8,10) beta-barrel and an all-alpha domain
  4. 1451043Superfamily e.5.1: Heme-dependent catalase-like [56634] (3 families) (S)
  5. 1451044Family e.5.1.1: Heme-dependent catalases [56635] (3 proteins)
  6. 1451194Protein automated matches [190051] (6 species)
    not a true protein
  7. 1451228Species Escherichia coli [TaxId:83333] [226042] (12 PDB entries)
  8. 1451265Domain d3p9sa1: 3p9s A:28-597 [233174]
    Other proteins in same PDB: d3p9sa2
    automated match to d1cf9a2
    complexed with hdd, hde

Details for d3p9sa1

PDB Entry: 3p9s (more details), 1.9 Å

PDB Description: structure of i274a variant of e. coli kate
PDB Compounds: (A:) catalase hpii

SCOPe Domain Sequences for d3p9sa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3p9sa1 e.5.1.1 (A:28-597) automated matches {Escherichia coli [TaxId: 83333]}
slapedgshrpaaeptppgaqptapgslkapdtrneklnsledvrkgsenyalttnqgvr
iaddqnslragsrgptlledfilrekithfdheriperivhargsaahgyfqpykslsdi
tkadflsdpnkitpvfvrfstvqggagsadtvrdirgfatkfyteegifdlvgnntpiff
iqdahkfpdfvhavkpephwaipqgqsahdtfwdyvslqpetlhnvmwamsdrgiprsyr
tmegfgahtfrlinaegkatfvrfhwkplagkaslvwdeaqkltgrdpdfhrrelweaie
agdfpeyelgfqlipeedefkfdfdlldptklipeelvpvqrvgkmvlnrnpdnffaene
qaafhpghivpgldftndpllqgrlfsytdtqisrlggpnfheipinrptcpyhnfqrdg
mhrmgidtnpanyepnsindnwpretppgpkrggfesyqervegnkvrerspsfgeyysh
prlfwlsqtpfeqrhivdgfsfelskvvrpyirervvdqlahidltlaqavaknlgielt
ddqlnitpppdvnglkkdpslslyaipdgd

SCOPe Domain Coordinates for d3p9sa1:

Click to download the PDB-style file with coordinates for d3p9sa1.
(The format of our PDB-style files is described here.)

Timeline for d3p9sa1: