![]() | Class b: All beta proteins [48724] (178 folds) |
![]() | Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
![]() | Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) ![]() |
![]() | Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins) automatically mapped to Pfam PF00983 |
![]() | Protein Tymovirus coat protein [88642] (3 species) |
![]() | Species PHMV (Physalis mottle virus) [TaxId:72539] [49642] (2 PDB entries) |
![]() | Domain d1qjzc_: 1qjz C: [23316] |
PDB Entry: 1qjz (more details), 3.8 Å
SCOPe Domain Sequences for d1qjzc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qjzc_ b.121.4.6 (C:) Tymovirus coat protein {PHMV (Physalis mottle virus) [TaxId: 72539]} mdssevvkvkqasipapgsilsqpnteqspaivlpfqfeattfgtaetaaqvslqtadpi tkltapyrhaqiveckailtptdlavsnpltvylawvpanspatptqilrvyggqsfvlg gaisaaktievplnldsvnrmlkdsvtytdtpkllaysraptnpskiptasiqisgrirl skpmlian
Timeline for d1qjzc_: