Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) |
Family c.23.10.0: automated matches [191588] (1 protein) not a true family |
Protein automated matches [191059] (12 species) not a true protein |
Species Parabacteroides distasonis [TaxId:435591] [233157] (1 PDB entry) |
Domain d3p94b1: 3p94 B:25-227 [233158] Other proteins in same PDB: d3p94a2, d3p94b2 automated match to d4iyja_ complexed with pg4 |
PDB Entry: 3p94 (more details), 1.93 Å
SCOPe Domain Sequences for d3p94b1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3p94b1 c.23.10.0 (B:25-227) automated matches {Parabacteroides distasonis [TaxId: 435591]} ekgdwaqfgryaeanktvkvpsnvvfmgnsitdgwwpadstffirnnfvdrgisgqttse mlvrfrqdvinlkpkavvilagindiahnngvialenvfgnlvsmaelakanhikvifcs vlpaydfpwrpgmqpadkviqlnkwikeyadkngltyvdyhsamkdernglpanlskdgv hptlegykimekivleaihktvk
Timeline for d3p94b1:
View in 3D Domains from other chains: (mouse over for more information) d3p94a1, d3p94a2, d3p94c_, d3p94d_ |