Lineage for d3p6aa1 (3p6a A:411-623)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2002135Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2002136Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2002198Family a.87.1.0: automated matches [233075] (1 protein)
    not a true family
  6. 2002199Protein automated matches [233076] (2 species)
    not a true protein
  7. 2002200Species Human (Homo sapiens) [TaxId:9606] [233077] (2 PDB entries)
  8. 2002201Domain d3p6aa1: 3p6a A:411-623 [233153]
    Other proteins in same PDB: d3p6aa2, d3p6ab2
    automated match to d1xcga1
    mutant

Details for d3p6aa1

PDB Entry: 3p6a (more details), 2.5 Å

PDB Description: Crystal Structure of the DH/PH domains of p115-RhoGEF (R399E mutant)
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d3p6aa1:

Sequence, based on SEQRES records: (download)

>d3p6aa1 a.87.1.0 (A:411-623) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclffpleelqnifpsldeliev
hslfldrlmkrrqesgylieeigdvllarfdgaegswfqkissrfcsrqsfaleqlkakq
rkdprfcafvqeaesrprcrrlqlkdmiptemqrltkyplllqsigqnteepterekvel
aaeccreilhhvnqavrdmedllrlkdyqrrld

Sequence, based on observed residues (ATOM records): (download)

>d3p6aa1 a.87.1.0 (A:411-623) automated matches {Human (Homo sapiens) [TaxId: 9606]}
pksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclffpleelqnifpsldeliev
hslfldrlmkrrqeslieeigdvllarfdgaegswfqkissrfcsrqsfaleqlkakqrk
dprfcafvqeaesrprcrrlqlkdmiptemqrltkyplllqsigqnteepterekvelaa
eccreilhhvnqavrdmedllrlkdyqrrld

SCOPe Domain Coordinates for d3p6aa1:

Click to download the PDB-style file with coordinates for d3p6aa1.
(The format of our PDB-style files is described here.)

Timeline for d3p6aa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3p6aa2