| Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (95 species) not a true protein |
| Species Ralstonia pickettii [TaxId:402626] [233147] (1 PDB entry) |
| Domain d3p0wc1: 3p0w C:6-153 [233150] Other proteins in same PDB: d3p0wa2, d3p0wb2, d3p0wc2, d3p0wd2 automated match to d4it1d1 complexed with gkr, mg |
PDB Entry: 3p0w (more details), 1.71 Å
SCOPe Domain Sequences for d3p0wc1:
Sequence, based on SEQRES records: (download)
>d3p0wc1 d.54.1.0 (C:6-153) automated matches {Ralstonia pickettii [TaxId: 402626]}
htprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqal
erviplvvgqsigrtngvlssirralagggnaahqatvhqvtsaseaavlrqpheinlrm
dnvitaveaalldllgqflevpvaellg
>d3p0wc1 d.54.1.0 (C:6-153) automated matches {Ralstonia pickettii [TaxId: 402626]}
htprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqal
erviplvvgqsigrtngvlssirralarmdnvitaveaalldllgqflevpvaellg
Timeline for d3p0wc1: