Lineage for d1qjzb_ (1qjz B:)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 569151Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 569256Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) (S)
  5. 569590Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein)
  6. 569591Protein Tymovirus coat protein [88642] (3 species)
  7. 569596Species PHMV (Physalis mottle virus) [TaxId:72539] [49642] (2 PDB entries)
  8. 569601Domain d1qjzb_: 1qjz B: [23315]

Details for d1qjzb_

PDB Entry: 1qjz (more details), 3.8 Å

PDB Description: three dimensional structure of physalis mottle virus : implications for the viral assembly

SCOP Domain Sequences for d1qjzb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjzb_ b.121.4.6 (B:) Tymovirus coat protein {PHMV (Physalis mottle virus)}
mdssevvkvkqasipapgsilsqpnteqspaivlpfqfeattfgtaetaaqvslqtadpi
tkltapyrhaqiveckailtptdlavsnpltvylawvpanspatptqilrvyggqsfvlg
gaisaaktievplnldsvnrmlkdsvtytdtpkllaysraptnpskiptasiqisgrirl
skpmlian

SCOP Domain Coordinates for d1qjzb_:

Click to download the PDB-style file with coordinates for d1qjzb_.
(The format of our PDB-style files is described here.)

Timeline for d1qjzb_: