Lineage for d3p0wb1 (3p0w B:6-153)

  1. Root: SCOPe 2.03
  2. 1396887Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1412713Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1412714Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1412983Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1412984Protein automated matches [226922] (55 species)
    not a true protein
  7. 1413225Species Ralstonia pickettii [TaxId:402626] [233147] (1 PDB entry)
  8. 1413227Domain d3p0wb1: 3p0w B:6-153 [233149]
    Other proteins in same PDB: d3p0wa2, d3p0wb2, d3p0wc2, d3p0wd2
    automated match to d4it1d1
    complexed with gkr, mg

Details for d3p0wb1

PDB Entry: 3p0w (more details), 1.71 Å

PDB Description: crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate
PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3p0wb1:

Sequence, based on SEQRES records: (download)

>d3p0wb1 d.54.1.0 (B:6-153) automated matches {Ralstonia pickettii [TaxId: 402626]}
htprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqal
erviplvvgqsigrtngvlssirralagggnaahqatvhqvtsaseaavlrqpheinlrm
dnvitaveaalldllgqflevpvaellg

Sequence, based on observed residues (ATOM records): (download)

>d3p0wb1 d.54.1.0 (B:6-153) automated matches {Ralstonia pickettii [TaxId: 402626]}
htprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqal
erviplvvgqsigrtngvlssirralaeinlrmdnvitaveaalldllgqflevpvaell
g

SCOPe Domain Coordinates for d3p0wb1:

Click to download the PDB-style file with coordinates for d3p0wb1.
(The format of our PDB-style files is described here.)

Timeline for d3p0wb1: