SCOPe 2.08: Domain d3p0wb1: 3p0w B:6-153

Lineage for d3p0wb1 (3p0w B:6-153)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (95 species)
   not a true protein

7. Species Ralstonia pickettii [TaxId:402626] [233147] (1 PDB entry)

8. Domain d3p0wb1: 3p0w B:6-153 [233149]
   Other proteins in same PDB: d3p0wa2, d3p0wb2, d3p0wc2, d3p0wd2
   automated match to d4it1d1
   complexed with gkr, mg

Details for d3p0wb1

PDB Entry: 3p0w, 1.71 Å

PDB Description: crystal structure of d-glucarate dehydratase from ralstonia solanacearum complexed with mg and d-glucarate

PDB Compounds: (B:) Mandelate racemase/muconate lactonizing protein

SCOPe Domain Sequences for d3p0wb1:

Sequence, based on SEQRES records:

>d3p0wb1 d.54.1.0 (B:6-153) automated matches {Ralstonia pickettii [TaxId: 402626]}
htprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqal
erviplvvgqsigrtngvlssirralagggnaahqatvhqvtsaseaavlrqpheinlrm
dnvitaveaalldllgqflevpvaellg

Sequence, based on observed residues (ATOM records):

>d3p0wb1 d.54.1.0 (B:6-153) automated matches {Ralstonia pickettii [TaxId: 402626]}
htprvtemqvipvagrdsmllnlcgahapfftrnlvilkdnagrtgvgevpggegirqal
erviplvvgqsigrtngvlssirralaeinlrmdnvitaveaalldllgqflevpvaell
g

Timeline for d3p0wb1:

• d3p0wb1 first appeared in SCOPe 2.03
  
• d3p0wb1 appears in SCOPe 2.07