SCOPe 2.05: Domain d3p05b1: 3p05 B:1-147

Lineage for d3p05b1 (3p05 B:1-147)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily)
   core: 5 helices; bundle

4. Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families)

5. Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins)

6. Protein automated matches [190369] (6 species)
   not a true protein

7. Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries)

8. Domain d3p05b1: 3p05 B:1-147 [233141]
   Other proteins in same PDB: d3p05a2, d3p05b2, d3p05c2, d3p05e2
   automated match to d1e6jp2
   complexed with iod

Details for d3p05b1

PDB Entry: 3p05, 2.5 Å

PDB Description: X-ray structure of pentameric HIV-1 CA

PDB Compounds: (B:) hiv-1 ca

SCOPe Domain Sequences for d3p05b1:

Sequence, based on SEQRES records:

>d3p05b1 a.73.1.1 (B:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth
nppipvgeiykrwiilglnkivrmysp

Sequence, based on observed residues (ATOM records):

>d3p05b1 a.73.1.1 (B:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]}
pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg
ghqaamqmlketineeaaewdrlhpmreprgsdiagttstlqeqigwmthnppipvgeiy
krwiilglnkivrmysp

Timeline for d3p05b1:

• d3p05b1 first appeared in SCOPe 2.03
  
• d3p05b1 appears in SCOPe 2.04
  
• d3p05b1 appears in SCOPe 2.06
  
• d3p05b1 appears in the current release, SCOPe 2.08