Class a: All alpha proteins [46456] (286 folds) |
Fold a.73: Retrovirus capsid protein, N-terminal core domain [47942] (1 superfamily) core: 5 helices; bundle |
Superfamily a.73.1: Retrovirus capsid protein, N-terminal core domain [47943] (2 families) |
Family a.73.1.1: Retrovirus capsid protein, N-terminal core domain [47944] (6 proteins) |
Protein automated matches [190369] (6 species) not a true protein |
Species Human immunodeficiency virus 1 [TaxId:11676] [187207] (7 PDB entries) |
Domain d3p05b1: 3p05 B:1-147 [233141] Other proteins in same PDB: d3p05a2, d3p05b2, d3p05c2, d3p05e2 automated match to d1e6jp2 complexed with iod |
PDB Entry: 3p05 (more details), 2.5 Å
SCOPe Domain Sequences for d3p05b1:
Sequence, based on SEQRES records: (download)
>d3p05b1 a.73.1.1 (B:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpvhagpiapgqmreprgsdiagttstlqeqigwmth nppipvgeiykrwiilglnkivrmysp
>d3p05b1 a.73.1.1 (B:1-147) automated matches {Human immunodeficiency virus 1 [TaxId: 11676]} pivqnlqgqmvhqaisprtlccwvkvveekafspevipmfsalsegatpqdlntmlntvg ghqaamqmlketineeaaewdrlhpmreprgsdiagttstlqeqigwmthnppipvgeiy krwiilglnkivrmysp
Timeline for d3p05b1: