Lineage for d1qjza_ (1qjz A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2430785Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 2431062Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families) (S)
  5. 2431628Family b.121.4.6: Tymoviridae-like VP [88641] (2 proteins)
    automatically mapped to Pfam PF00983
  6. 2431629Protein Tymovirus coat protein [88642] (3 species)
  7. 2431634Species PHMV (Physalis mottle virus) [TaxId:72539] [49642] (2 PDB entries)
  8. 2431638Domain d1qjza_: 1qjz A: [23314]

Details for d1qjza_

PDB Entry: 1qjz (more details), 3.8 Å

PDB Description: three dimensional structure of physalis mottle virus : implications for the viral assembly
PDB Compounds: (A:) coat protein

SCOPe Domain Sequences for d1qjza_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qjza_ b.121.4.6 (A:) Tymovirus coat protein {PHMV (Physalis mottle virus) [TaxId: 72539]}
kqasipapgsilsqpnteqspaivlpfqfeattfgtaetaaqvslqtadpitkltapyrh
aqiveckailtptdlavsnpltvylawvpanspatptqilrvyggqsfvlggaisaakti
evplnldsvnrmlkdsvtytdtpkllaysraptnpskiptasiqisgrirlskpmlian

SCOPe Domain Coordinates for d1qjza_:

Click to download the PDB-style file with coordinates for d1qjza_.
(The format of our PDB-style files is described here.)

Timeline for d1qjza_: