SCOP 1.71: Domain d1qjza_: 1qjz A:

Lineage for d1qjza_ (1qjz A:)

1. Root: SCOP 1.71

2. Class b: All beta proteins [48724] (149 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families)

5. Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein)

6. Protein Tymovirus coat protein [88642] (3 species)

7. Species PHMV (Physalis mottle virus) [TaxId:72539] [49642] (2 PDB entries)

8. Domain d1qjza_: 1qjz A: [23314]

Details for d1qjza_

PDB Entry: 1qjz, 3.8 Å

PDB Description: three dimensional structure of physalis mottle virus : implications for the viral assembly

SCOP Domain Sequences for d1qjza_:

Sequence; same for both SEQRES and ATOM records:

>d1qjza_ b.121.4.6 (A:) Tymovirus coat protein {PHMV (Physalis mottle virus)}
kqasipapgsilsqpnteqspaivlpfqfeattfgtaetaaqvslqtadpitkltapyrh
aqiveckailtptdlavsnpltvylawvpanspatptqilrvyggqsfvlggaisaakti
evplnldsvnrmlkdsvtytdtpkllaysraptnpskiptasiqisgrirlskpmlian

Timeline for d1qjza_:

• d1qjza_ first appeared (with stable ids) in SCOP 1.55
  
• d1qjza_ appears in SCOP 1.69
  
• d1qjza_ appears in SCOP 1.73
  
• d1qjza_ appears in the current release, SCOPe 2.08