SCOPe 2.06: Domain d3oxnc_: 3oxn C:

Lineage for d3oxnc_ (3oxn C:)

1. Root: SCOPe 2.06

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
   consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
   mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest

4. Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families)
   Similar in architecture to the superfamily I but partly differs in topology

5. Family c.94.1.0: automated matches [191309] (1 protein)
   not a true family

6. Protein automated matches [190039] (140 species)
   not a true protein

7. Species Vibrio parahaemolyticus [TaxId:670] [233133] (1 PDB entry)

8. Domain d3oxnc_: 3oxn C: [233135]
   automated match to d2y7wc_
   complexed with so4

Details for d3oxnc_

PDB Entry: 3oxn, 2.7 Å

PDB Description: the crystal structure of a putative transcriptional regulator from vibrio parahaemolyticus

PDB Compounds: (C:) Putative transcriptional regulator, LysR family

SCOPe Domain Sequences for d3oxnc_:

Sequence, based on SEQRES records:

>d3oxnc_ c.94.1.0 (C:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
fdpqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadl
aicrptgpveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkali
eqalidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydlvvkplpfqftp
fdysmiwharcehspaqewlrsvvreecsrliakr

Sequence, based on observed residues (ATOM records):

>d3oxnc_ c.94.1.0 (C:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
fdpqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadl
aicrptveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkalieq
alidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydlvvkplpfqftpfd
ysmiwharcehspaqewlrsvvreecsrliakr

Timeline for d3oxnc_:

• d3oxnc_ first appeared in SCOPe 2.03
  
• d3oxnc_ appears in SCOPe 2.05
  
• d3oxnc_ appears in SCOPe 2.07
  
• d3oxnc_ appears in the current release, SCOPe 2.08