![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily) consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest |
![]() | Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) ![]() Similar in architecture to the superfamily I but partly differs in topology |
![]() | Family c.94.1.0: automated matches [191309] (1 protein) not a true family |
![]() | Protein automated matches [190039] (161 species) not a true protein |
![]() | Species Vibrio parahaemolyticus [TaxId:670] [233133] (1 PDB entry) |
![]() | Domain d3oxna_: 3oxn A: [233134] automated match to d2y7wc_ complexed with so4 |
PDB Entry: 3oxn (more details), 2.7 Å
SCOPe Domain Sequences for d3oxna_:
Sequence, based on SEQRES records: (download)
>d3oxna_ c.94.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]} pqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadlai crptgpveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkalieq alidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydlvvkplpfqftpfd ysmiwharcehspaqewlrsvvreecsrliakrie
>d3oxna_ c.94.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]} pqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadlai crptgpveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkalieq alidkpqrkmvlrayhleaalaivlpiiitvpadlaylvaerydlvvkplpfqftpfdys miwharcehspaqewlrsvvreecsrliakrie
Timeline for d3oxna_: