Lineage for d3oxna_ (3oxn A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2913607Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 2913608Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 2915150Family c.94.1.0: automated matches [191309] (1 protein)
    not a true family
  6. 2915151Protein automated matches [190039] (161 species)
    not a true protein
  7. 2916418Species Vibrio parahaemolyticus [TaxId:670] [233133] (1 PDB entry)
  8. 2916419Domain d3oxna_: 3oxn A: [233134]
    automated match to d2y7wc_
    complexed with so4

Details for d3oxna_

PDB Entry: 3oxn (more details), 2.7 Å

PDB Description: the crystal structure of a putative transcriptional regulator from vibrio parahaemolyticus
PDB Compounds: (A:) Putative transcriptional regulator, LysR family

SCOPe Domain Sequences for d3oxna_:

Sequence, based on SEQRES records: (download)

>d3oxna_ c.94.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
pqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadlai
crptgpveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkalieq
alidkpqrkmvlrayhleaalaivdtlpiiitvpadlaylvaerydlvvkplpfqftpfd
ysmiwharcehspaqewlrsvvreecsrliakrie

Sequence, based on observed residues (ATOM records): (download)

>d3oxna_ c.94.1.0 (A:) automated matches {Vibrio parahaemolyticus [TaxId: 670]}
pqqcdqtftiattdyamqtilpfalpriyqeapnvsfnflplqhdrlsdqltyegadlai
crptgpveplrseilgrvgvlcllskqhplanqemslddylshphamiaisdgvkalieq
alidkpqrkmvlrayhleaalaivlpiiitvpadlaylvaerydlvvkplpfqftpfdys
miwharcehspaqewlrsvvreecsrliakrie

SCOPe Domain Coordinates for d3oxna_:

Click to download the PDB-style file with coordinates for d3oxna_.
(The format of our PDB-style files is described here.)

Timeline for d3oxna_: