Lineage for d1auyc_ (1auy C:)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 382736Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
    sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
    characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies
  4. 382819Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) (S)
  5. 383153Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein)
  6. 383154Protein Tymovirus coat protein [88642] (3 species)
  7. 383166Species TYMV (Turnip yellow mosaic virus) [TaxId:12154] [49640] (1 PDB entry)
  8. 383169Domain d1auyc_: 1auy C: [23313]

Details for d1auyc_

PDB Entry: 1auy (more details), 3.2 Å

PDB Description: turnip yellow mosaic virus

SCOP Domain Sequences for d1auyc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auyc_ b.121.4.6 (C:) Tymovirus coat protein {TYMV (Turnip yellow mosaic virus)}
meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
splitdtst

SCOP Domain Coordinates for d1auyc_:

Click to download the PDB-style file with coordinates for d1auyc_.
(The format of our PDB-style files is described here.)

Timeline for d1auyc_: