SCOPe 2.07: Domain d3osfa2: 3osf A:97-150

Lineage for d3osfa2 (3osf A:97-150)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.1: Homeodomain-like [46689] (20 families)
   consists only of helices

5. Family a.4.1.0: automated matches [191447] (1 protein)
   not a true family

6. Protein automated matches [190674] (25 species)
   not a true protein

7. Species Trichomonas vaginalis [TaxId:5722] [233124] (4 PDB entries)

8. Domain d3osfa2: 3osf A:97-150 [233126]
   automated match to d1gv2a2
   protein/DNA complex; complexed with ipa

Details for d3osfa2

PDB Entry: 3osf, 2.03 Å

PDB Description: The structure of protozoan parasite Trichomonas vaginalis Myb2 in complex with MRE-2f-13 DNA

PDB Compounds: (A:) myb21

SCOPe Domain Sequences for d3osfa2:

Sequence; same for both SEQRES and ATOM records:

>d3osfa2 a.4.1.0 (A:97-150) automated matches {Trichomonas vaginalis [TaxId: 5722]}
sishtpwtaeedallvqkiqeygrqwaiiakffpgrtdihiknrwvtisnklgi

Timeline for d3osfa2:

• d3osfa2 first appeared in SCOPe 2.03
  
• d3osfa2 appears in SCOPe 2.06
  
• d3osfa2 appears in the current release, SCOPe 2.08