![]() | Class a: All alpha proteins [46456] (290 folds) |
![]() | Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies) core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down |
![]() | Superfamily a.4.1: Homeodomain-like [46689] (21 families) ![]() consists only of helices |
![]() | Family a.4.1.0: automated matches [191447] (1 protein) not a true family |
![]() | Protein automated matches [190674] (25 species) not a true protein |
![]() | Species Trichomonas vaginalis [TaxId:5722] [233124] (4 PDB entries) |
![]() | Domain d3osfa2: 3osf A:97-150 [233126] automated match to d1gv2a2 protein/DNA complex; complexed with ipa |
PDB Entry: 3osf (more details), 2.03 Å
SCOPe Domain Sequences for d3osfa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3osfa2 a.4.1.0 (A:97-150) automated matches {Trichomonas vaginalis [TaxId: 5722]} sishtpwtaeedallvqkiqeygrqwaiiakffpgrtdihiknrwvtisnklgi
Timeline for d3osfa2: