Class b: All beta proteins [48724] (149 folds) |
Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies) sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies |
Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families) |
Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein) |
Protein Tymovirus coat protein [88642] (3 species) |
Species TYMV (Turnip yellow mosaic virus) [TaxId:12154] [49640] (2 PDB entries) |
Domain d1auyb_: 1auy B: [23312] |
PDB Entry: 1auy (more details), 3.2 Å
SCOP Domain Sequences for d1auyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auyb_ b.121.4.6 (B:) Tymovirus coat protein {TYMV (Turnip yellow mosaic virus)} meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh splitdtst
Timeline for d1auyb_: