SCOP 1.69: Domain d1auyb_: 1auy B:

Lineage for d1auyb_ (1auy B:)

1. Root: SCOP 1.69

2. Class b: All beta proteins [48724] (144 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families)

5. Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein)

6. Protein Tymovirus coat protein [88642] (3 species)

7. Species TYMV (Turnip yellow mosaic virus) [TaxId:12154] [49640] (2 PDB entries)

8. Domain d1auyb_: 1auy B: [23312]

Details for d1auyb_

PDB Entry: 1auy, 3.2 Å

PDB Description: turnip yellow mosaic virus

SCOP Domain Sequences for d1auyb_:

Sequence; same for both SEQRES and ATOM records:

>d1auyb_ b.121.4.6 (B:) Tymovirus coat protein {TYMV (Turnip yellow mosaic virus)}
meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
splitdtst

Timeline for d1auyb_:

• d1auyb_ first appeared (with stable ids) in SCOP 1.55
  
• d1auyb_ appears in SCOP 1.67
  
• d1auyb_ appears in SCOP 1.71
  
• d1auyb_ appears in the current release, SCOPe 2.08