Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) |
Protein TYMV coat protein [49639] (1 species) |
Species Turnip yellow mosaic virus [TaxId:12154] [49640] (1 PDB entry) |
Domain d1auyb_: 1auy B: [23312] |
PDB Entry: 1auy (more details), 3.2 Å
SCOP Domain Sequences for d1auyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auyb_ b.10.1.2 (B:) TYMV coat protein {Turnip yellow mosaic virus} meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh splitdtst
Timeline for d1auyb_: