Lineage for d1auyb_ (1auy B:)
- Root: SCOP 1.55
Class b: All beta proteins [48724] (93 folds) 
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) 
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) 
Protein TYMV coat protein [49639] (1 species) Species Turnip yellow mosaic virus [TaxId:12154] [49640] (1 PDB entry) 
Domain d1auyb_: 1auy B: [23312]
Details for d1auyb_
PDB Entry: 1auy (more details), 3.2 Å
PDB Description: turnip yellow mosaic virus
SCOP Domain Sequences for d1auyb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1auyb_ b.10.1.2 (B:) TYMV coat protein {Turnip yellow mosaic virus}
meidkelapqdrtvtvatvlpavpgpspltikqpfqsevlfagtkdaeasltianidsvs
tlttfyrhasleslwvtihptlqaptfpttvgvcwvpaqspvtpaqitktyggqifcigg
aiqtlsplivkcplemmqprvkdsiqyldspkllisitaqptappastciitvsgtlsmh
splitdtst
SCOP Domain Coordinates for d1auyb_:
Click to download the PDB-style file with coordinates for d1auyb_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1auyb_:
- d1auyb_ appears in SCOP 1.57
- d1auyb_ appears in the current release, SCOPe 2.08
View in 3D
