Lineage for d3oona1 (3oon A:268-388)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2958618Fold d.79: Bacillus chorismate mutase-like [55297] (9 superfamilies)
    core: beta-alpha-beta-alpha-beta(2); mixed beta-sheet: order: 1423, strand 4 is antiparallel to the rest
  4. 2960608Superfamily d.79.7: OmpA-like [103088] (2 families) (S)
  5. 2960634Family d.79.7.0: automated matches [195454] (1 protein)
    not a true family
  6. 2960635Protein automated matches [195455] (14 species)
    not a true protein
  7. 2960681Species Borrelia burgdorferi [TaxId:224326] [233118] (1 PDB entry)
  8. 2960682Domain d3oona1: 3oon A:268-388 [233119]
    Other proteins in same PDB: d3oona2
    automated match to d4g4wa_
    complexed with so4

Details for d3oona1

PDB Entry: 3oon (more details), 1.79 Å

PDB Description: the structure of an outer membrance protein from borrelia burgdorferi b31
PDB Compounds: (A:) Outer membrane protein (Tpn50)

SCOPe Domain Sequences for d3oona1:

Sequence, based on SEQRES records: (download)

>d3oona1 d.79.7.0 (A:268-388) automated matches {Borrelia burgdorferi [TaxId: 224326]}
aieveknnkginlsfdiefypnsfqilqkeykkidliakllekfkknnilieghteqfgl
eeemhelsekraraignylikmkvkdkdqilfkgwgsqkpkypkssplkaknrrveitil
n

Sequence, based on observed residues (ATOM records): (download)

>d3oona1 d.79.7.0 (A:268-388) automated matches {Borrelia burgdorferi [TaxId: 224326]}
aieveknnkginlsfdiefypnsfqilqkeykkidliakllekfkknnilieghteqfgl
eeemhelsekraraignylikmkvkdkdqilfkgwgsqkaknrrveitiln

SCOPe Domain Coordinates for d3oona1:

Click to download the PDB-style file with coordinates for d3oona1.
(The format of our PDB-style files is described here.)

Timeline for d3oona1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3oona2