Lineage for d3ooja2 (3ooj A:241-608)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1621518Fold c.80: SIS domain [53696] (1 superfamily)
    3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345
  4. 1621519Superfamily c.80.1: SIS domain [53697] (4 families) (S)
  5. 1621520Family c.80.1.1: double-SIS domain [53698] (5 proteins)
    duplication: consists of two SIS domains related by pseudo dyad
  6. 1621549Protein automated matches [227069] (2 species)
    not a true protein
  7. Species Escherichia coli [TaxId:562] [233109] (4 PDB entries)
  8. 1621553Domain d3ooja2: 3ooj A:241-608 [233114]
    Other proteins in same PDB: d3ooja1, d3oojb1, d3oojc1, d3oojd1, d3ooje1, d3oojf1, d3oojg1, d3oojh1
    automated match to d4amva1
    complexed with g6p, g6q, glu, gol; mutant

Details for d3ooja2

PDB Entry: 3ooj (more details), 2.5 Å

PDB Description: c1a mutant of e. coli glms in complex with glucose-6p and glutamate
PDB Compounds: (A:) Glucosamine/fructose-6-phosphate aminotransferase, isomerizing

SCOPe Domain Sequences for d3ooja2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ooja2 c.80.1.1 (A:241-608) automated matches {Escherichia coli [TaxId: 562]}
dagdkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilac
gtsynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglr
lskelgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvakls
rlkgldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypial
egalklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarg
gqlyvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprn
laksvtve

SCOPe Domain Coordinates for d3ooja2:

Click to download the PDB-style file with coordinates for d3ooja2.
(The format of our PDB-style files is described here.)

Timeline for d3ooja2: