Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
Fold c.80: SIS domain [53696] (1 superfamily) 3 layers: a/b/a; parallel beta-sheet of 5 strands, order 21345 |
Superfamily c.80.1: SIS domain [53697] (4 families) |
Family c.80.1.1: double-SIS domain [53698] (5 proteins) duplication: consists of two SIS domains related by pseudo dyad |
Protein automated matches [227069] (2 species) not a true protein |
Species Escherichia coli [TaxId:562] [233109] (1 PDB entry) |
Domain d3oojc2: 3ooj C:244-608 [233112] Other proteins in same PDB: d3ooja1, d3oojb1, d3oojc1 automated match to d4amva1 complexed with g6p, g6q, glu, gol; mutant |
PDB Entry: 3ooj (more details), 2.5 Å
SCOPe Domain Sequences for d3oojc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3oojc2 c.80.1.1 (C:244-608) automated matches {Escherichia coli [TaxId: 562]} dkgiyrhymqkeiyeqpnaikntltgrishgqvdlselgpnadellskvehiqilacgts ynsgmvsrywfeslagipcdveiasefryrksavrrnslmitlsqsgetadtlaglrlsk elgylgslaicnvpgsslvresdlalmtnagteigvastkafttqltvllmlvaklsrlk gldasiehdivhglqalpsrieqmlsqdkriealaedfsdkhhalflgrgdqypialega lklkeisyihaeayaagelkhgplalidadmpvivvapnnelleklksnieevrarggql yvfadqdagfvssdnmhiiemphveeviapifytvplqllayhvalikgtdvdqprnlak svtve
Timeline for d3oojc2:
View in 3D Domains from other chains: (mouse over for more information) d3ooja1, d3ooja2, d3oojb1, d3oojb2 |