Lineage for d3oojc1 (3ooj C:1-236)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2988339Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies)
    4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing
  4. 2988340Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) (S)
    N-terminal residue provides two catalytic groups, nucleophile and proton donor
  5. 2995888Family d.153.1.0: automated matches [191393] (1 protein)
    not a true family
  6. 2995889Protein automated matches [190509] (19 species)
    not a true protein
  7. 2996342Species Escherichia coli [TaxId:562] [233107] (3 PDB entries)
  8. 2996349Domain d3oojc1: 3ooj C:1-236 [233111]
    Other proteins in same PDB: d3ooja2, d3oojb2, d3oojc2, d3oojd2, d3ooje2, d3oojf2, d3oojg2, d3oojh2
    automated match to d4amva2
    complexed with g6p, g6q, glu, gol; mutant

Details for d3oojc1

PDB Entry: 3ooj (more details), 2.5 Å

PDB Description: c1a mutant of e. coli glms in complex with glucose-6p and glutamate
PDB Compounds: (C:) Glucosamine/fructose-6-phosphate aminotransferase, isomerizing

SCOPe Domain Sequences for d3oojc1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3oojc1 d.153.1.0 (C:1-236) automated matches {Escherichia coli [TaxId: 562]}
agivgaiaqrdvaeilleglrrleyrgydsaglavvdaeghmtrlrrlgkvqmlaqaaee
hplhggtgiahtrwathgepsevnahphvsehivvvhngiienheplreelkargytfvs
etdteviahlvnwelkqggtlreavlraipqlrgaygtvimdsrhpdtllaarsgsplvi
glgmgenfiasdqlallpvtrrfifleegdiaeitrrsvnifdktgaevkrqdies

SCOPe Domain Coordinates for d3oojc1:

Click to download the PDB-style file with coordinates for d3oojc1.
(The format of our PDB-style files is described here.)

Timeline for d3oojc1: