SCOP 1.67: Domain d1auya_: 1auy A:

Lineage for d1auya_ (1auy A:)

1. Root: SCOP 1.67

2. Class b: All beta proteins [48724] (141 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (8 families)

5. Family b.121.4.6: Tymoviridae-like VP [88641] (1 protein)

6. Protein Tymovirus coat protein [88642] (3 species)

7. Species TYMV (Turnip yellow mosaic virus) [TaxId:12154] [49640] (1 PDB entry)

8. Domain d1auya_: 1auy A: [23311]

Details for d1auya_

PDB Entry: 1auy, 3.2 Å

PDB Description: turnip yellow mosaic virus

SCOP Domain Sequences for d1auya_:

Sequence; same for both SEQRES and ATOM records:

>d1auya_ b.121.4.6 (A:) Tymovirus coat protein {TYMV (Turnip yellow mosaic virus)}
spltikqpfqsevlfagtkdaeasltianidsvstlttfyrhasleslwvtihptlqapt
fpttvgvcwvpaqspvtpaqitktyggqifciggaiqtlsplivkcplemmqprvkdsiq
yldspkllisitaqptappastciitvsgtlsmhsplitdtst

Timeline for d1auya_:

• d1auya_ first appeared (with stable ids) in SCOP 1.55
  
• d1auya_ appears in SCOP 1.65
  
• d1auya_ appears in SCOP 1.69
  
• d1auya_ appears in the current release, SCOPe 2.08