Lineage for d1auya_ (1auy A:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 11446Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)
  4. 11447Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) (S)
  5. 11461Family b.10.1.2: Plant virus proteins [49616] (15 proteins)
  6. 11529Protein TYMV coat protein [49639] (1 species)
  7. 11530Species Turnip yellow mosaic virus [TaxId:12154] [49640] (1 PDB entry)
  8. 11531Domain d1auya_: 1auy A: [23311]

Details for d1auya_

PDB Entry: 1auy (more details), 3.2 Å

PDB Description: turnip yellow mosaic virus

SCOP Domain Sequences for d1auya_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1auya_ b.10.1.2 (A:) TYMV coat protein {Turnip yellow mosaic virus}
spltikqpfqsevlfagtkdaeasltianidsvstlttfyrhasleslwvtihptlqapt
fpttvgvcwvpaqspvtpaqitktyggqifciggaiqtlsplivkcplemmqprvkdsiq
yldspkllisitaqptappastciitvsgtlsmhsplitdtst

SCOP Domain Coordinates for d1auya_:

Click to download the PDB-style file with coordinates for d1auya_.
(The format of our PDB-style files is described here.)

Timeline for d1auya_: