SCOPe 2.03: Domain d3om9a2: 3om9 A:164-335

Lineage for d3om9a2 (3om9 A:164-335)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (7 species)
   not a true protein

7. Species Toxoplasma gondii [TaxId:5811] [233101] (1 PDB entry)

8. Domain d3om9a2: 3om9 A:164-335 [233102]
   Other proteins in same PDB: d3om9a1, d3om9b1, d3om9c1
   automated match to d1pzgc2

Details for d3om9a2

PDB Entry: 3om9, 1.98 Å

PDB Description: T. Gondii bradyzoite-specific LDH (LDH1) in complex with NAD and OXQ

PDB Compounds: (A:) lactate dehydrogenase

SCOPe Domain Sequences for d3om9a2:

Sequence; same for both SEQRES and ATOM records:

>d3om9a2 d.162.1.1 (A:164-335) automated matches {Toxoplasma gondii [TaxId: 5811]}
acmldsgrfrryvadalsvsprdvqatvigthgdcmvplvryitvngypiqkfikdgvvt
ekqleeiaehtkvsggeivrflgqgsayyapaasavamatsflndekrvipcsvycngey
glkdmfiglpaviggagiervielelneeekkqfqksvddvmalnkavaalqapg

Timeline for d3om9a2:

• d3om9a2 is new in SCOPe 2.03-stable
  
• d3om9a2 appears in SCOPe 2.04
  
• d3om9a2 appears in the current release, SCOPe 2.08