SCOPe 2.06: Domain d1c8nc_: 1c8n C:

Lineage for d1c8nc_ (1c8n C:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.121: Nucleoplasmin-like/VP (viral coat and capsid proteins) [88632] (7 superfamilies)
   sandwich; 8 strands in 2 sheets; jelly-roll; some members can have additional 1-2 strands
   characteristic interaction between the domains of this fold allows the formation of five-fold and pseudo six-fold assemblies

4. Superfamily b.121.4: Positive stranded ssRNA viruses [88633] (10 families)

5. Family b.121.4.7: Tombusviridae-like VP [88643] (5 proteins)

6. Protein Necrovirus coat protein [49637] (1 species)

7. Species TNV (Tobacco necrosis virus) [TaxId:12054] [49638] (1 PDB entry)

8. Domain d1c8nc_: 1c8n C: [23310]
   complexed with ca

Details for d1c8nc_

PDB Entry: 1c8n, 2.25 Å

PDB Description: tobacco necrosis virus

PDB Compounds: (C:) coat protein

SCOPe Domain Sequences for d1c8nc_:

Sequence; same for both SEQRES and ATOM records:

>d1c8nc_ b.121.4.7 (C:) Necrovirus coat protein {TNV (Tobacco necrosis virus) [TaxId: 12054]}
gvsraggfvtapvigamvtrptvprfgmrgnstvvsnselilnltpialaytvqslplia
tqpawlgtiadnyskwrwvslriiyspkcptttsgtvamclsydrndvapgsrvqlsqty
kainfppyagydgaailntdvtptsaiyvdvdvtrfdkawystigtaafaaltafdqnqf
cpctvhigsdggpavavppgdiffkyvieliepinptmn

Timeline for d1c8nc_:

• d1c8nc_ first appeared (with stable ids) in SCOP 1.55
  
• d1c8nc_ appears in SCOPe 2.05
  
• d1c8nc_ appears in SCOPe 2.07
  
• d1c8nc_ appears in the current release, SCOPe 2.08