Class b: All beta proteins [48724] (93 folds) |
Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily) |
Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families) |
Family b.10.1.2: Plant virus proteins [49616] (15 proteins) |
Protein TNV coat protein [49637] (1 species) |
Species Tobacco necrosis virus [TaxId:12054] [49638] (1 PDB entry) |
Domain d1c8nc_: 1c8n C: [23310] |
PDB Entry: 1c8n (more details), 2.25 Å
SCOP Domain Sequences for d1c8nc_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1c8nc_ b.10.1.2 (C:) TNV coat protein {Tobacco necrosis virus} gvsraggfvtapvigamvtrptvprfgmrgnstvvsnselilnltpialaytvqslplia tqpawlgtiadnyskwrwvslriiyspkcptttsgtvamclsydrndvapgsrvqlsqty kainfppyagydgaailntdvtptsaiyvdvdvtrfdkawystigtaafaaltafdqnqf cpctvhigsdggpavavppgdiffkyvieliepinptmn
Timeline for d1c8nc_: