| Class b: All beta proteins [48724] (178 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.2: Periplasmic domain of cytochrome c oxidase subunit II [49541] (3 proteins) |
| Protein automated matches [233094] (2 species) not a true protein |
| Species Rhodobacter sphaeroides [TaxId:272943] [233095] (6 PDB entries) |
| Domain d3om3b2: 3om3 B:130-281 [233098] Other proteins in same PDB: d3om3a_, d3om3b1, d3om3b3, d3om3c_, d3om3d1, d3om3d3 automated match to d1m56b1 complexed with ca, cd, cu1, dmu, hea, hth, mg, trd; mutant |
PDB Entry: 3om3 (more details), 2.6 Å
SCOPe Domain Sequences for d3om3b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3om3b2 b.6.1.2 (B:130-281) automated matches {Rhodobacter sphaeroides [TaxId: 272943]}
peadvtvkvtgyqwywgyeypdeeisfesymigspatggdnrmspeveqqlieagysrde
fllatdtamvvpvnktvvvqvtgadvihswtvpafgvkqdavpgrlaqlwfraeregiff
gqcselcgishaympitvkvvseeayaawleq
Timeline for d3om3b2: