SCOP 1.59: Domain d1c8nb_: 1c8n B:

Lineage for d1c8nb_ (1c8n B:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.10: Viral coat and capsid proteins [49610] (1 superfamily)

4. Superfamily b.10.1: Viral coat and capsid proteins [49611] (4 families)

5. Family b.10.1.2: Plant virus proteins [49616] (15 proteins)

6. Protein TNV coat protein [49637] (1 species)

7. Species Tobacco necrosis virus [TaxId:12054] [49638] (1 PDB entry)

8. Domain d1c8nb_: 1c8n B: [23309]

Details for d1c8nb_

PDB Entry: 1c8n, 2.25 Å

PDB Description: tobacco necrosis virus

SCOP Domain Sequences for d1c8nb_:

Sequence; same for both SEQRES and ATOM records:

>d1c8nb_ b.10.1.2 (B:) TNV coat protein {Tobacco necrosis virus}
stvvsnselilnltpialaytvqslpliatqpawlgtiadnyskwrwvslriiyspkcpt
ttsgtvamclsydrndvapgsrvqlsqtykainfppyagydgaailntdvtptsaiyvdv
dvtrfdkawystigtaafaaltafdqnqfcpctvhigsdggpavavppgdiffkyvieli
epinptmnv

Timeline for d1c8nb_:

• d1c8nb_ first appeared (with stable ids) in SCOP 1.55
  
• d1c8nb_ appears in SCOP 1.57
  
• d1c8nb_ appears in SCOP 1.61
  
• d1c8nb_ appears in the current release, SCOPe 2.08