![]() | Class b: All beta proteins [48724] (176 folds) |
![]() | Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
![]() | Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) ![]() |
![]() | Family b.82.3.0: automated matches [227198] (1 protein) not a true family |
![]() | Protein automated matches [226927] (11 species) not a true protein |
![]() | Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [233085] (1 PDB entry) |
![]() | Domain d3of1a1: 3of1 A:171-293 [233086] automated match to d1cx4a1 complexed with cmp |
PDB Entry: 3of1 (more details), 2.21 Å
SCOPe Domain Sequences for d3of1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3of1a1 b.82.3.0 (A:171-293) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} qlqrleksirnnflfnkldsdskrlvincleeksvpkgatiikqgdqgdyfyvvekgtvd fyvndnkvnssgpgssfgelalmynspraatvvatsdcllwaldrltfrkillgssfkkr lmy
Timeline for d3of1a1: