Lineage for d3odoa2 (3odo A:624-761)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1798838Fold b.55: PH domain-like barrel [50728] (2 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 1798839Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 1799421Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 1799422Protein automated matches [190052] (5 species)
    not a true protein
  7. 1799448Species Human (Homo sapiens) [TaxId:9606] [186914] (36 PDB entries)
  8. 1799478Domain d3odoa2: 3odo A:624-761 [233081]
    Other proteins in same PDB: d3odoa1, d3odob1
    automated match to d1xcga2

Details for d3odoa2

PDB Entry: 3odo (more details), 2.9 Å

PDB Description: Crystal Structure of the DH/PH Domains of p115-RhoGEF
PDB Compounds: (A:) Rho guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d3odoa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3odoa2 b.55.1.0 (A:624-761) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lshlrqssdpmlsefknlditkkklvhegpltwrvtkdkavevhvlllddlllllqrqde
rlllkshsrtltptpdgktmlrpvlrltsamtrevatdhkafyvlftwdqeaqiyelvaq
tvserknwcalitetags

SCOPe Domain Coordinates for d3odoa2:

Click to download the PDB-style file with coordinates for d3odoa2.
(The format of our PDB-style files is described here.)

Timeline for d3odoa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3odoa1