SCOPe 2.07: Domain d3odob1: 3odo B:395-623

Lineage for d3odob1 (3odo B:395-623)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
   multihelical; core: 5-helical bundle

4. Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families)
   automatically mapped to Pfam PF00621

5. Family a.87.1.0: automated matches [233075] (1 protein)
   not a true family

6. Protein automated matches [233076] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [233077] (2 PDB entries)

8. Domain d3odob1: 3odo B:395-623 [233080]
   Other proteins in same PDB: d3odoa2, d3odoa3, d3odob2, d3odob3
   automated match to d1xcga1

Details for d3odob1

PDB Entry: 3odo, 2.9 Å

PDB Description: Crystal Structure of the DH/PH Domains of p115-RhoGEF

PDB Compounds: (B:) Rho guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d3odob1:

Sequence; same for both SEQRES and ATOM records:

>d3odob1 a.87.1.0 (B:395-623) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppgwrelvppdtlhslpksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclffpl
eelqnifpsldelievhslfldrlmkrrqesgylieeigdvllarfdgaegswfqkissr
fcsrqsfaleqlkakqrkdprfcafvqeaesrprcrrlqlkdmiptemqrltkyplllqs
igqnteepterekvelaaeccreilhhvnqavrdmedllrlkdyqrrld

Timeline for d3odob1:

• d3odob1 first appeared in SCOPe 2.03
  
• d3odob1 appears in SCOPe 2.06
  
• d3odob1 appears in the current release, SCOPe 2.08