Lineage for d3odob1 (3odo B:395-623)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719559Fold a.87: DBL homology domain (DH-domain) [48064] (1 superfamily)
    multihelical; core: 5-helical bundle
  4. 2719560Superfamily a.87.1: DBL homology domain (DH-domain) [48065] (2 families) (S)
    automatically mapped to Pfam PF00621
  5. 2719629Family a.87.1.0: automated matches [233075] (1 protein)
    not a true family
  6. 2719630Protein automated matches [233076] (2 species)
    not a true protein
  7. 2719631Species Human (Homo sapiens) [TaxId:9606] [233077] (2 PDB entries)
  8. 2719635Domain d3odob1: 3odo B:395-623 [233080]
    Other proteins in same PDB: d3odoa2, d3odoa3, d3odob2, d3odob3
    automated match to d1xcga1

Details for d3odob1

PDB Entry: 3odo (more details), 2.9 Å

PDB Description: Crystal Structure of the DH/PH Domains of p115-RhoGEF
PDB Compounds: (B:) Rho guanine nucleotide exchange factor 1

SCOPe Domain Sequences for d3odob1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3odob1 a.87.1.0 (B:395-623) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ppgwrelvppdtlhslpksqvkrqevisellvteaahvrmlrvlhdlffqpmaeclffpl
eelqnifpsldelievhslfldrlmkrrqesgylieeigdvllarfdgaegswfqkissr
fcsrqsfaleqlkakqrkdprfcafvqeaesrprcrrlqlkdmiptemqrltkyplllqs
igqnteepterekvelaaeccreilhhvnqavrdmedllrlkdyqrrld

SCOPe Domain Coordinates for d3odob1:

Click to download the PDB-style file with coordinates for d3odob1.
(The format of our PDB-style files is described here.)

Timeline for d3odob1: