Lineage for d3ocia2 (3oci A:114-197)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975209Superfamily d.129.1: TATA-box binding protein-like [55945] (3 families) (S)
  5. 2975391Family d.129.1.0: automated matches [227265] (1 protein)
    not a true family
  6. 2975392Protein automated matches [227057] (4 species)
    not a true protein
  7. 2975393Species Fungus (Encephalitozoon cuniculi) [TaxId:6035] [232060] (3 PDB entries)
  8. 2975399Domain d3ocia2: 3oci A:114-197 [233068]
    automated match to d1ytba2
    complexed with edo

Details for d3ocia2

PDB Entry: 3oci (more details), 1.9 Å

PDB Description: Crystal structure of TBP (TATA box binding protein)
PDB Compounds: (A:) transcription initiation factor tfiid (tfiid-1)

SCOPe Domain Sequences for d3ocia2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ocia2 d.129.1.0 (A:114-197) automated matches {Fungus (Encephalitozoon cuniculi) [TaxId: 6035]}
kiqnivsscdikfsirleglayahsnycsyepelfpgliyrmvkpkivllifvsgkivlt
gakvrddiyqafnniypvliqhrk

SCOPe Domain Coordinates for d3ocia2:

Click to download the PDB-style file with coordinates for d3ocia2.
(The format of our PDB-style files is described here.)

Timeline for d3ocia2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3ocia1