Lineage for d3obvd_ (3obv D:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2725421Fold a.118: alpha-alpha superhelix [48370] (28 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2725422Superfamily a.118.1: ARM repeat [48371] (28 families) (S)
  5. 2726002Family a.118.1.23: Diap1 N-terninal region-like [140830] (2 proteins)
    contains two consequitive Pfam domains in one superhelical segment: Pfam PF06371 and Pfam PF06367
    this is a repeat family; one repeat unit is 2bap A:217-262 found in domain
  6. 2726003Protein Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) [140831] (1 species)
  7. 2726004Species Mouse (Mus musculus) [TaxId:10090] [140832] (4 PDB entries)
    Uniprot O08808 133-475! Uniprot O08808 135-435! Uniprot O08808 83-443
  8. 2726008Domain d3obvd_: 3obv D: [233064]
    automated match to d3obva_

Details for d3obvd_

PDB Entry: 3obv (more details), 2.75 Å

PDB Description: autoinhibited formin mdia1 structure
PDB Compounds: (D:) Protein diaphanous homolog 1

SCOPe Domain Sequences for d3obvd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3obvd_ a.118.1.23 (D:) Diaphanous protein homolog 1, Diap1 (Dia1, DRF1) {Mouse (Mus musculus) [TaxId: 10090]}
essrsammyiqelrsglrdmhllscleslrvslnnnpvswvqtfgaeglaslldilkrlh
dekeetsgnydsrnqheiirclkafmnnkfgiktmleteegilllvramdpavpnmmida
akllsalcilpqpedmnervleamteraemdeverfqplldglksgtsialkvgclqlin
alitpaeeldfrvhirselmrlglhqvlqelreienedmkvqlcvfdeqgdedffdlkgr
lddirmemddfgevfqiilntvkdskaephflsilqhlllvrndyearpqyyklieecvs
qivlhkngtdpdfkcrhlqidierlvd

SCOPe Domain Coordinates for d3obvd_:

Click to download the PDB-style file with coordinates for d3obvd_.
(The format of our PDB-style files is described here.)

Timeline for d3obvd_: